Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d048693_circ_g.2 |
ID in PlantcircBase | zma_circ_007949 |
Alias | Zm04circ00004, GRMZM2G062129_C1 |
Organism | Zea mays |
Position | chr4: 3410725-3411424 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d048693 |
Parent gene annotation |
ATA15 protein |
Parent gene strand | + |
Alternative splicing | Zm00001d048693_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d048693_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.138611179 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3411399-3410793(+) 3410954-3411413(-) 3410732-3411097(-) 3410755-3411093(-) |
Potential amino acid sequence |
MEDAFMALKWHNKAEQTRMPGCCCFGPGVSQT*(+) MVKKRCSLLHCVVNLLSILPCTSIKFEKPQAQNSSILACAFVQPCYATSMP*(-) MPLQCHESVFHGTSFNNQVSSSQVCLQGTITPMFVCSFLQV*(-) MRVCSALLCHFNAMKASSMARRLTTKSARRRSASKAPSLQCLSAAFFKSD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |