Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d048693_circ_g.2 |
| ID in PlantcircBase | zma_circ_007949 |
| Alias | Zm04circ00004, GRMZM2G062129_C1 |
| Organism | Zea mays |
| Position | chr4: 3410725-3411424 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d048693 |
| Parent gene annotation |
ATA15 protein |
| Parent gene strand | + |
| Alternative splicing | Zm00001d048693_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d048693_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.138611179 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3411399-3410793(+) 3410954-3411413(-) 3410732-3411097(-) 3410755-3411093(-) |
| Potential amino acid sequence |
MEDAFMALKWHNKAEQTRMPGCCCFGPGVSQT*(+) MVKKRCSLLHCVVNLLSILPCTSIKFEKPQAQNSSILACAFVQPCYATSMP*(-) MPLQCHESVFHGTSFNNQVSSSQVCLQGTITPMFVCSFLQV*(-) MRVCSALLCHFNAMKASSMARRLTTKSARRRSASKAPSLQCLSAAFFKSD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |