Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0816300_circ_g.4 |
| ID in PlantcircBase | osa_circ_017146 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 34983415-34985006 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0816300 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os02t0816300-01) ;Hypothetical conserved gene. (Os02t0816300-02);Hypothetical con served gene. (Os02t0816300-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0816300_circ_g.1 Os02g0816300_circ_g.2 Os02g0816300_circ_g.3 Os02g0816300_circ_g.5 Os02g0816300_circ_g.6 Os02g0816300_circ_g.7 Os02g0816300_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0816300-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.144717201 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34984322-34983487(+) 34983442-34983447(+) |
| Potential amino acid sequence |
MQLVRSDQVLEHATECFQGFGLNVRISCFHRLNHPGRKCCRLFSLPYAPKAACDPTHNPDSG*( +) MLLKQLVTPLITQILDRRSSVVKQACHLLNFLSKELLRDFEPCAELLIPVLLKNVVITIHVIAE SSDNCIKEMLRNCKVARILPKIIEFAKNDKSAVLRARCCEYAILMLELWVDTPEIQRSVDLYEE FIKCCIEDATSEVRSSARACYRMFSRIWPERSHQLFSSFESSRQKVLPTIQPSLCS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |