Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0003s05500_circ_g.1 |
| ID in PlantcircBase | pop_circ_000936 |
| Alias | Chr03:8332438-8333510 |
| Organism | Populus trichocarpa |
| Position | chr3: 6800142-6801213 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0003s05500 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | POPTR_0003s05500_circ_g.2 |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0003s05500.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.144595126 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6801175-6800170(+) 6800195-6800165(+) 6801207-6800165(+) |
| Potential amino acid sequence |
METVGRVSYVQWKVSRGTLYFLA*(+) MRGDPYCVAHFLESRGMIEDALEVATDPDYRFELAIQLGRLEVAKEIAIEVQSESKWKQLGELA MSNGKCHGVHFTS*(+) MESVTGYTLLLSLIEYKTLVMRGDPYCVAHFLESRGMIEDALEVATDPDYRFELAIQLGRLEVA KEIAIEVQSESKWKQLGELAMSNGKCHGVHFTS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |