Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G46590_circ_g.3 |
| ID in PlantcircBase | ath_circ_026276 |
| Alias | AT3G46590_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 17154449-17154741 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT3G46590 |
| Parent gene annotation |
Telomere repeat-binding protein 2 |
| Parent gene strand | + |
| Alternative splicing | AT3G46590_circ_g.1 AT3G46590_circ_g.2 AT3G46590_circ_g.4 AT3G46590_circ_g.5 AT3G46590_circ_g.6 AT3G46590_circ_g.7 AT3G46590_circ_g.8 |
| Support reads | 4 |
| Tissues | whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G46590.3:2 AT3G46590.5:2 AT3G46590.4:2 AT3G46590.1:2 AT3G46590.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.437608691 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17154699-17154738(+) |
| Potential amino acid sequence |
MKSRNASFVSRDHHDAKPWYCSKRSYYLHHHQRSYPIKKRKYFDSVYDSNSDDYRLQGKTHKGS RTISSMKSRNASFVSRDHHDAKPWYCSKRSYYLHHHQRSYPIKKRKYFDSVYDSNSDDYRLQGK THKGSRTISSMKSRNASFVSRDHHDAKPWYCSKRSYYLHHHQRSYPIKKRKYFDSVYDSNSDDY RLQGKTHKGSRTISSMKSRNASFVSRDHH(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |