Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0540100_circ_g.2 |
| ID in PlantcircBase | osa_circ_009523 |
| Alias | Os_ciR7080 |
| Organism | Oryza sativa |
| Position | chr11: 19733107-19733246 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os11g0540100 |
| Parent gene annotation |
Similar to Xaa-Pro aminopeptidase 2 (EC 3.4.11.9). (Os11t0540100 -01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0540100_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0540100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.241167143 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19733110-19733167(-) 19733231-19733228(-) |
| Potential amino acid sequence |
MFGSYHYEGGATVDGWALLFAGREAAQ*(-) MKEALLWTDGRYFLQAEKQLSDHWELMCMGEDPPVEVWIADVWLLSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |