Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0539700_circ_g.3 |
| ID in PlantcircBase | osa_circ_028698 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 26810258-26810856 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0539700 |
| Parent gene annotation |
Similar to Nucleosome assembly protein 1. (Os05t0539700-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0539700_circ_g.1 Os05g0539700_circ_g.2 Os05g0539700_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0539700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.28175946 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26810546-26810350(+) 26810558-26810843(-) |
| Potential amino acid sequence |
MVLHGIKPELWYTLLLFLLCRGFICSFFGDTIYLNHTIHDFITPMAFSRIGSSSSIMWYVLVST EFLKNGLVSK*(+) MKNHEILSEEIQERDEEALKYLKDIKWYRISEPKGFKLEFYFDTNPFFKNSVLTKTYHMIDEDE PILEKAIGVMKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |