Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0375200_circ_g.2 |
| ID in PlantcircBase | osa_circ_001756 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 15489386-15489870 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0375200 |
| Parent gene annotation |
Similar to shikimate biosynthesis protein aroDE. (Os01t0375200-0 1);Similar to shikimate biosynthesis protein aroDE. (Os01t037520 0-02);Similar to shikimate biosynthesis protein aroDE. (Os01t037 5200-03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0375200_circ_g.2 Os01g0375200_circ_ag.1 Os01g0375200_circ_ag.3 Os01g0375200_circ_ag.4 Os01g0375200_circ_ag.5 |
| Support reads | 1 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0375200-02:3 Os01t0375200-03:3 Os01t0375200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009475 |
| PMCS | 0.686796923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15489564-15489627(-) |
| Potential amino acid sequence |
MVFMAPIDLATGSCSWQHCTASTLKGREQRRYDLLLQLLHPSPLPHKQLPYQLHQHLQQQQACQ PKVRWQHPLILGLLCHPQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |