Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d021532_circ_g.1 |
ID in PlantcircBase | zma_circ_009419 |
Alias | zma_circ_0002603 |
Organism | Zea mays |
Position | chr7: 155248272-155248560 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d021532 |
Parent gene annotation |
RING/U-box superfamily protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d021532_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.171963956 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
155248519-155248539(-) |
Potential amino acid sequence |
MNQLLLTALQKQRQQRMMDDFGGYYDERMYWRQNDEIRDADKEASAPCSLAPVAHLGAHQQESW QHSSFGSQHQHHDNQNLLKKGLKVS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |