Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0374575_circ_g.1 |
| ID in PlantcircBase | osa_circ_020000 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 14752043-14753788 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0374575 |
| Parent gene annotation |
Similar to RNA recognition motif family protein, expressed. (Os0 3t0374575-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0374575-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1160269 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14753784-14753661(-) 14752162-14753768(-) |
| Potential amino acid sequence |
MGRGYDYGPSPPREYRRRARSPSPRGRYGGRDRDLPTSLLVRNLRRDCRPDDLRRPFGKFGRVK DIYLPRDYYTGEPRGFGFIQYYDPEDAADAKYHMDGQILLGREVTVVFAEENRKKPSEMRARER VGSRDRSYDRRSRSPRYSRSRSPVYSPRSRSRSRSYSPAPKRKHYSRSLWEEAMIMVHHRQENT GEEPAAQVLVGAMEAVTGISQLVFW*(-) MIAGRALLDTPAQGHLCTLQDHGPVVEATHLHLRESTIQDHYGKRL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |