Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc12g088370.1_circ_g.1 |
| ID in PlantcircBase | sly_circ_003661 |
| Alias | SL3.0ch12:64763650|64764151 |
| Organism | Solanum lycopersicum |
| Position | chr12: 63782731-63783232 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI; find_circ |
| Parent gene | Solyc12g088370.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc12g088370.1.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.359335937 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
63782962-63782766(+) 63783232-63782766(+) 63782768-63783187(-) |
| Potential amino acid sequence |
MLEESVSPITEALKSRSDASKISSLLECLAIITFVGGEEPEETEKSMQLMWQVIHPKIGPNVCH FVATMFEFH*(+) MFATLLQQCLNSIKRGSSKEITLASHVLGLLALTAGLGDKAHEMLEESVSPITEALKSRSDASK ISSLLECLAIITFVGGEEPEETEKSMQLMWQVIHPKIGPNVCHFVATMFEFH*(+) MEFKHCCNKVANIRANFWMNDLPHQLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to low-temperature stress |
| Other Information | |
|---|---|
| References | Yang et al., 2020 |