Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Gh_A05G0368_circ_g.2 |
ID in PlantcircBase | ghi_circ_000480 |
Alias | A05:4058358|4058605 |
Organism | Gossypium hirsutum |
Position | chrA05: 4058358-4058605 JBrowse» |
Reference genome | v1.1 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gh_A05G0368 |
Parent gene annotation |
SIMILAR TO: AT4G32900, Peptidyl-tRNA hydrolase II (PTH2) family protein |
Parent gene strand | - |
Alternative splicing | Gh_A05G0368_circ_g.1 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Gh_A05G0368:2 |
Conservation Information | |
---|---|
Conserved circRNAs | gar_circ_000027 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4058418-4058605(-) |
Potential amino acid sequence |
MQLRILAFQLLLLLMLEEHSDRSLLREWEDCGQPKIVVSCRNQQEMNKLRDAAEDIGLPTFVVA DAGRTQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |