Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Gh_A05G0368_circ_g.2 |
| ID in PlantcircBase | ghi_circ_000480 |
| Alias | A05:4058358|4058605 |
| Organism | Gossypium hirsutum |
| Position | chrA05: 4058358-4058605 JBrowse» |
| Reference genome | v1.1 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gh_A05G0368 |
| Parent gene annotation |
SIMILAR TO: AT4G32900, Peptidyl-tRNA hydrolase II (PTH2) family protein |
| Parent gene strand | - |
| Alternative splicing | Gh_A05G0368_circ_g.1 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gh_A05G0368:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000027 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4058418-4058605(-) |
| Potential amino acid sequence |
MQLRILAFQLLLLLMLEEHSDRSLLREWEDCGQPKIVVSCRNQQEMNKLRDAAEDIGLPTFVVA DAGRTQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |