Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G264200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000406 |
| Alias | Chr04:59946698|59947158 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 59946698-59947158 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G264200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.004G264200.1:3 Gorai.004G264200.3:3 Gorai.004G264200.4:3 Gorai.004G264200.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.470909996 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
59946701-59946698(+) 59946739-59947064(-) 59946749-59947137(-) |
| Potential amino acid sequence |
MENVVRIRGRTDMSVHQGKMIVVKAMVALFLLPLLPVKLRQPTCLFVVLMKAMVACPSQKTTHQ ILRHPPPEICQKALGSYRKMFHMISVTSS*(+) MSVLPRIRTTFSISCSSLKSYETSFGSSPELSDRFLGEDASISDE*(-) MYTHVCPPSYPDYILHQLLVTEII*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |