Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G24620_circ_g.6 |
ID in PlantcircBase | ath_circ_032614 |
Alias | At_ciR3439 |
Organism | Arabidpsis thaliana |
Position | chr4: 12710869-12711012 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, find_circ |
Parent gene | AT4G24620 |
Parent gene annotation |
Glucose-6-phosphate isomerase |
Parent gene strand | - |
Alternative splicing | AT4G24620_circ_g.3 AT4G24620_circ_g.4 AT4G24620_circ_g.5 AT4G24620_circ_g.7 |
Support reads | 2/5 |
Tissues | leaf/leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G24620.1:1 AT4G24620.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.197334261 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12710938-12710871(-) |
Potential amino acid sequence |
MYDWVGGRTSIMSAVGLLPAALQGVAITQENSLLDNTARIEGWLARFPMYDWVGGRTSIMSAVG LLPAALQGVAITQENSLLDNTARIEGWLARFPMYDWVGGRTSIMSAVGLLPAALQGVAITQENS LLDNTARIEGWLARFPMYDWVGGRTSIMSAVGLLPAALQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |