Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G24620_circ_g.6 |
| ID in PlantcircBase | ath_circ_032614 |
| Alias | At_ciR3439 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 12710869-12711012 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, find_circ |
| Parent gene | AT4G24620 |
| Parent gene annotation |
Glucose-6-phosphate isomerase |
| Parent gene strand | - |
| Alternative splicing | AT4G24620_circ_g.3 AT4G24620_circ_g.4 AT4G24620_circ_g.5 AT4G24620_circ_g.7 |
| Support reads | 2/5 |
| Tissues | leaf/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G24620.1:1 AT4G24620.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.197334261 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12710938-12710871(-) |
| Potential amino acid sequence |
MYDWVGGRTSIMSAVGLLPAALQGVAITQENSLLDNTARIEGWLARFPMYDWVGGRTSIMSAVG LLPAALQGVAITQENSLLDNTARIEGWLARFPMYDWVGGRTSIMSAVGLLPAALQGVAITQENS LLDNTARIEGWLARFPMYDWVGGRTSIMSAVGLLPAALQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |