Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0641700_circ_g.4 |
ID in PlantcircBase | osa_circ_020756 |
Alias | Os03circ20876 |
Organism | Oryza sativa |
Position | chr3: 24729376-24729771 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os03g0641700 |
Parent gene annotation |
Similar to predicted protein. (Os03t0641700-01);Conserved hypoth etical protein. (Os03t0641700-02) |
Parent gene strand | + |
Alternative splicing | Os03g0641700_circ_g.1 Os03g0641700_circ_g.2 Os03g0641700_circ_g.3 Os03g0641700_circ_g.5 Os03g0641700_circ_g.6 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0641700-02:2 Os03t0641700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.429720349 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24729621-24729377(+) |
Potential amino acid sequence |
MRRRGSKRDWKIWQVVITPRKAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHR HKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKKRKQEGLEDLASGHNPKKG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |