Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G18410_circ_g.5 |
| ID in PlantcircBase | ath_circ_038993 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 6101669-6101878 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT5G18410 |
| Parent gene annotation |
transcription activators |
| Parent gene strand | - |
| Alternative splicing | AT5G18410_circ_g.6 |
| Support reads | 10 |
| Tissues | inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G18410.3:1 AT5G18410.2:1 AT5G18410.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.518655794 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6101816-6101671(-) |
| Potential amino acid sequence |
MYDMVVEGFQLLSRWTARIWEQCAWKFSRPCRDAGETPEASGSYSDYEKLLLLKSNDGAYTEWC REVKGNMYDMVVEGFQLLSRWTARIWEQCAWKFSRPCRDAGETPEASGSYSDYEKLLLLKSNDG AYTEWCREVKGNMYDMVVEGFQLLSRWTARIWEQCAWKFSRPCRDAGETPEASGSYSDYEKLLL LKSNDGAYTEWCREVKGNMYDMVVEGFQLLSRWTARIWEQCAWKFSRPCRDAGETPEASGSYSD YEK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |