Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0636900_circ_g.7 |
ID in PlantcircBase | osa_circ_009852 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 25152280-25152736 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0636900 |
Parent gene annotation |
Similar to Splicing factor U2af large subunit A. (Os11t0636900-0 1);Nucleotide-binding, alpha-beta plait domain containing protei n. (Os11t0636900-02) |
Parent gene strand | - |
Alternative splicing | Os11g0636900_circ_g.1 Os11g0636900_circ_g.2 Os11g0636900_circ_g.3 Os11g0636900_circ_g.4 Os11g0636900_circ_g.5 Os11g0636900_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0636900-01:2 Os11t0636900-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.241156492 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25152720-25152360(+) 25152722-25152719(-) |
Potential amino acid sequence |
MWLCLVLDRERERDLDLRSRPFEGERERDRCLR*(+) MMAGPQSLERGKENGTRTRNATETVIETEGTATVVTRTGTVIATGSTAIEAKEGNTTIVNVLMT VIDAGAMILKGEETVTEMVTAGIDLAPAPLQRVVIADLDLAHALDLARDTAT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |