Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0234200_circ_g.1 |
| ID in PlantcircBase | osa_circ_014000 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 7597098-7598501 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0234200 |
| Parent gene annotation |
NHL domain-containing protein, Determination of panicle architec ture, grain shape and grain weight (Os02t0234200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0234200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137403365 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7597237-7597140(+) 7597206-7597100(+) 7597133-7598430(-) |
| Potential amino acid sequence |
MLHLGKLPFRKKIVPTRMQLFYRQISYWSLVLLLPDIFSLLCNMDLGHQLLKRSDHHCWWKIKH PRL*(+) MCSLLVIDRGNAALRKIALPQEDCTYQDATLLSSDIILVIGAVVAGYIFSVVQHGFGSSTAEKE *(+) MFDFPPAMVVTPFQQLMTQIHVAQQRKYIRQQQHQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |