Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0234200_circ_g.1 |
ID in PlantcircBase | osa_circ_014000 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 7597098-7598501 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0234200 |
Parent gene annotation |
NHL domain-containing protein, Determination of panicle architec ture, grain shape and grain weight (Os02t0234200-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0234200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.137403365 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7597237-7597140(+) 7597206-7597100(+) 7597133-7598430(-) |
Potential amino acid sequence |
MLHLGKLPFRKKIVPTRMQLFYRQISYWSLVLLLPDIFSLLCNMDLGHQLLKRSDHHCWWKIKH PRL*(+) MCSLLVIDRGNAALRKIALPQEDCTYQDATLLSSDIILVIGAVVAGYIFSVVQHGFGSSTAEKE *(+) MFDFPPAMVVTPFQQLMTQIHVAQQRKYIRQQQHQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |