Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Bra017049_circ_g.2 |
| ID in PlantcircBase | bra_circ_000207 |
| Alias | A04:17020342|17021115 |
| Organism | Brassica rapa |
| Position | chrA04: 17020342-17021115 JBrowse» |
| Reference genome | Brassica rapa v2 |
| Type | ie-circRNA |
| Identification method | Find_circ |
| Parent gene | Bra017049 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | Bra036602_circ_g.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Bra0A170A49:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.043091904 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17020363-17020353(+) |
| Potential amino acid sequence |
MQGWLDKLLKYSKQVAGICSVLEVMESAFKGSVSPQLQDVEKLKDNIGKTKQHLDIMIWCIRHG FLHDVKSRYSNFTSWKALVLERKSNAIKRAWPDAVDQSSDCSVQGASLFIEDALENLEREPEYS QDIGADLGVGCLQNDERSFLRSRIEGTSGSYPFENLRTAADKLFLHGSSDLVVAKQAIIVLK* |
| Sponge-miRNAs | bra-miR5716 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2019 |