Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d011446_circ_g.1 |
| ID in PlantcircBase | zma_circ_009730 |
| Alias | zma_circ_0002853 |
| Organism | Zea mays |
| Position | chr8: 150562689-150563156 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d011446 |
| Parent gene annotation |
NAD(P)-binding Rossmann-fold superfamily protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d011446_T001:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.245292776 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
150563150-150563138(+) 150563152-150563112(-) |
| Potential amino acid sequence |
MCFFEIRDGRGGVAAAEPRTSDKRGADGDQLQVSSPRRPPRSLLCRRFAKCEPQLEKRRITVCG FFLVVAAEALVAPAALVDGGRAPPVMRVVLPPHARQQGRGEDAFPDGLCPDAGLNHPLRCLGF* (+) MAALEAQAAERVIEACVRTESVRKCVFTSSLLACVWRQDYPHDRRCPTTIDESCWSDESFCRDN KEEATYCDASFFQLWFALGKTAAEKAAWRAARGRDLKLVTICPALVTGPGFRRRNSTASIAYLK EAHGSVRSPSSGAGD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |