Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0287000_circ_g.5 |
ID in PlantcircBase | osa_circ_014306 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 10824548-10824685 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0287000 |
Parent gene annotation |
Similar to 40S ribosomal protein S3a (CYC07 protein). (Os02t0287 000-01);Ribosomal protein S3Ae domain containing protein. (Os02t 0287000-02) |
Parent gene strand | - |
Alternative splicing | Os02g0287000_circ_g.1 Os02g0287000_circ_g.2 Os02g0287000_circ_g.3 Os02g0287000_circ_g.4 |
Support reads | 123 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0287000-02:1 Os02t0287000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.280919746 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10824663-10824682(+) 10824629-10824550(-) |
Potential amino acid sequence |
MLETLRCNPEIREDIPPLNILSTKSNLPVSLILVILKIRQGDFKDTMLETLRCNPEIREDIPPL NILSTKSNLPVSLILVILKIRQGDFKDTMLETLRCNPEIREDIPPLNILSTKSNLPVSLILVIL KIRQGDFKDTMLETLRCN(+) MTRIRLTGRLDFVLRMFRGGMSSRISGLHLRVSSIVSLKSPWRIFRMTRIRLTGRLDFVLRMFR GGMSSRISGLHLRVSSIVSLKSPWRIFRMTRIRLTGRLDFVLRMFRGGMSSRISGLHLRVSSIV SLKSPWRIFRMTRIRLTGRLDFVLRMFRGGMSSRIS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |