Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0287000_circ_g.5 |
| ID in PlantcircBase | osa_circ_014306 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 10824548-10824685 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0287000 |
| Parent gene annotation |
Similar to 40S ribosomal protein S3a (CYC07 protein). (Os02t0287 000-01);Ribosomal protein S3Ae domain containing protein. (Os02t 0287000-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0287000_circ_g.1 Os02g0287000_circ_g.2 Os02g0287000_circ_g.3 Os02g0287000_circ_g.4 |
| Support reads | 123 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0287000-02:1 Os02t0287000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.280919746 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10824663-10824682(+) 10824629-10824550(-) |
| Potential amino acid sequence |
MLETLRCNPEIREDIPPLNILSTKSNLPVSLILVILKIRQGDFKDTMLETLRCNPEIREDIPPL NILSTKSNLPVSLILVILKIRQGDFKDTMLETLRCNPEIREDIPPLNILSTKSNLPVSLILVIL KIRQGDFKDTMLETLRCN(+) MTRIRLTGRLDFVLRMFRGGMSSRISGLHLRVSSIVSLKSPWRIFRMTRIRLTGRLDFVLRMFR GGMSSRISGLHLRVSSIVSLKSPWRIFRMTRIRLTGRLDFVLRMFRGGMSSRISGLHLRVSSIV SLKSPWRIFRMTRIRLTGRLDFVLRMFRGGMSSRIS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |