Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0135900_circ_g.4 |
ID in PlantcircBase | osa_circ_035761 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 2031295-2031737 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0135900 |
Parent gene annotation |
Similar to Tryptophan synthase beta chain 1 (EC 4.2.1.20) (Orang e pericarp 1) (Fragment). (Os08t0135900-01);Similar to Tryptopha n synthase beta-subunit. (Os08t0135900-02);Similar to Tryptophan synthase beta-subunit. (Os08t0135900-03) |
Parent gene strand | + |
Alternative splicing | Os08g0135900_circ_g.1 Os08g0135900_circ_g.2 Os08g0135900_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0136001-00:1 Os08t0135900-01:1 Os08t0135900-03:1 Os08t0136001-00:1 Os08t0135900-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.724940835 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2031425-2031295(+) 2031684-2031353(+) 2031352-2031730(-) 2031311-2031683(-) |
Potential amino acid sequence |
MMVREFHKVIGKETRRQAMEKWGGKPDVLVACVGGGSNAMGLFHEFVDDQDIRMIGVEAAGYGV DTDKHAATLTKGEVGVLHGSLSYVLQDDDGQVIEPHSISAG*(+) MCCRMMMDKLLNPTPLVLGEGSTFWDSNFEGCHLGGHP*(+) MASEVASFKVAVPECTALTQH*(-) MYCPHPALMEWGSITCPSSSCNT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |