Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0135900_circ_g.4 |
| ID in PlantcircBase | osa_circ_035761 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 2031295-2031737 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0135900 |
| Parent gene annotation |
Similar to Tryptophan synthase beta chain 1 (EC 4.2.1.20) (Orang e pericarp 1) (Fragment). (Os08t0135900-01);Similar to Tryptopha n synthase beta-subunit. (Os08t0135900-02);Similar to Tryptophan synthase beta-subunit. (Os08t0135900-03) |
| Parent gene strand | + |
| Alternative splicing | Os08g0135900_circ_g.1 Os08g0135900_circ_g.2 Os08g0135900_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0136001-00:1 Os08t0135900-01:1 Os08t0135900-03:1 Os08t0136001-00:1 Os08t0135900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.724940835 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2031425-2031295(+) 2031684-2031353(+) 2031352-2031730(-) 2031311-2031683(-) |
| Potential amino acid sequence |
MMVREFHKVIGKETRRQAMEKWGGKPDVLVACVGGGSNAMGLFHEFVDDQDIRMIGVEAAGYGV DTDKHAATLTKGEVGVLHGSLSYVLQDDDGQVIEPHSISAG*(+) MCCRMMMDKLLNPTPLVLGEGSTFWDSNFEGCHLGGHP*(+) MASEVASFKVAVPECTALTQH*(-) MYCPHPALMEWGSITCPSSSCNT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |