Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0307800_circ_g.2 |
| ID in PlantcircBase | osa_circ_038815 |
| Alias | Os_ciR12019 |
| Organism | Oryza sativa |
| Position | chr9: 8041805-8044901 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0307800 |
| Parent gene annotation |
SET domain-containing histone methyltransferase, H3 lysine 36 (H 3K36) methylation, Flowering promotion (Os09t0307800-01);Similar to histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysi ne-20specific. (Os09t0307800-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0307800_circ_g.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0307800-02:5 Os09t0307800-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117575727 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8044833-8041893(+) 8042375-8043617(-) |
| Potential amino acid sequence |
MLERFVSTFILTFTGRRTTREQHHAVTSMPQTDNLPNTILQICLSFLPDMLIL*(+) MVIDATNKGNMSRFINHSCEPNTEMQKWTVEGETRVGIFALRDIKTGEELTYDYKFVQFGADQD CHCGSSNCRKMLGITKPVNSIVLHNGNLSQDQHVRKKRKTYLENCIGEIVRLWHRRHSMMLFSC CSSTCKCENKCANKPFQHRTLRKTKLIKFLLDREMWQWGGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |