Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G10530_circ_g.1 |
ID in PlantcircBase | ath_circ_020883 |
Alias | At_ciR4540 |
Organism | Arabidpsis thaliana |
Position | chr3: 3286262-3286666 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | AT3G10530 |
Parent gene annotation |
F18K10.11 protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G10530.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.189535473 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3286277-3286663(+) |
Potential amino acid sequence |
MEISSEDNNLMEKVLPPVEQESDVELETKVKKYLRGEGANLETLKDKKLKTQLASREKLYGKSA KAAAKIEKVIRIKMEISSEDNNLMEKVLPPVEQESDVELETKVKKYLRGEGANLETLKDKKLKT QLASREKLYGKSAKAAAKIEKVIRIKMEISSEDNNLMEKVLPPVEQESDVELETKVKKYLRGEG ANLETLKDKKLKTQLASREKLYGKSAKAAAKIEKVIRIKMEISSEDNNLMEKVLPPVEQESDVE LETKVKKYLRGEGANLETLKDKKLKTQLASREKLYGKSAKAAAKIEK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |