Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0557700_circ_g.2 |
| ID in PlantcircBase | osa_circ_028880 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 27742395-27742601 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0557700 |
| Parent gene annotation |
Ubiquitin-conjugating E2 enzyme, Phosphate homeostasis, Negative regulator of the inorganic phosphate (Pi)-starvation response-s ignaling pathway (Os05t0557700-01);Pi starvation-induced isoform , Regulation of Pi homeostasis (Os05t0557700-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0557700-01:1 Os05t0557700-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.100241546 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27742519-27742397(-) |
| Potential amino acid sequence |
MELITQFEKPTLASENAMTKGFDVVTDCSDHHFVKEIGHENVNADSQYQIVTTAELQPSAEDIS EEKQTMELITQFEKPTLASENAMTKGFDVVTDCSDHHFVKEIGHENVNADSQYQIVTTAELQPS AEDISEEKQTMELITQFEKPTLASENAMTKGFDVVTDCSDHHFVKEIGHENVNADSQYQIVTTA ELQPSAEDISEEKQTMELITQFEKPTLASENAMTKGFDVVTDCSDHHFVKEIGHEN(-) |
| Sponge-miRNAs | osa-miR5508 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |