Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0562100_circ_g.4 |
ID in PlantcircBase | osa_circ_008017 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 22175651-22175871 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0562100 |
Parent gene annotation |
Homeodomain-like containing protein. (Os10t0562100-01);Similar t o Transcription factor MYBS2. (Os10t0562100-02) |
Parent gene strand | - |
Alternative splicing | Os10g0562100_circ_g.2 Os10g0562100_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0562100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.442317345 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22175794-22175651(+) 22175864-22175651(+) |
Potential amino acid sequence |
MPLQSPFPSCLSPSRNFLCSSSVHGTPDHHCTQQQHQRGWPGASFCQGWSAGGSTSGRGWPPES PSCWSQSSWRCLSSPLSPAASALPGISCAPPQSMVPLIITALSNNIKEAGPALLFARVGLPEEV LLGVAGHLSRRPAGHKVLGDASPVPFPQLPQPFQEFLVLLLSPWYP*(+) MVPLIITALSNNIKEAGPALLFARVGLPEEVLLGVAGHLSRRPAGHKVLGDASPVPFPQLPQPF QEFLVLLLSPWYP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |