Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d032567_circ_g.2 |
| ID in PlantcircBase | zma_circ_006805 |
| Alias | Zm01circ00147, zma_circ_0000426, GRMZM2G119657_C1 |
| Organism | Zea mays |
| Position | chr1: 230724608-230725226 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d032567 |
| Parent gene annotation |
Mediator of RNA polymerase II transcription subunit 16 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d032567_circ_g.1 Zm00001d032567_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d032567_T021:1 Zm00001d032567_T008:1 Zm00001d032567_T002:1 Zm00001d032567_T020:1 Zm00001d032567_T004:1 Zm00001d032567_T007:1 Zm00001d032567_T018:1 Zm00001d032567_T019:1 Zm00001d032567_T009:1 Zm00001d032567_T016:1 Zm00001d032567_T001:1 Zm00001d032567_T022:1 Zm00001d032567_T013:1 Zm00001d032567_T003:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.689694469 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
230725130-230724641(+) 230725220-230725207(-) |
| Potential amino acid sequence |
MKNNRLARRFPALHPPSGDRRSFIRVIRRHVLPYLLLHVPMLLS*(+) MSPYDPDEGPSITGWRVQCWESSCQPVVLHPIFGSPTSLGGQPPMQTVWSTRVNKSIPPTEDLK NPQTYVPMPTTSDERSSSECSVDRANRLSFDPYDLPNDVRQLAQIVYSAHGGEVAVAFLRGGVH IFSGPNFDQVDSYHVNVGSAIAPPAFSSSSCCLASVWHDTLKDRTILKIIRVLPPAILSTQTKI SSAAWERAIADRAVHVSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |