Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0146200_circ_g.1 |
| ID in PlantcircBase | osa_circ_008423 |
| Alias | Os11circ00292/Os_ciR1959 |
| Organism | Oryza sativa |
| Position | chr11: 2092925-2093293 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl, find_circ |
| Parent gene | Os11g0146200 |
| Parent gene annotation |
Ankyrin repeat domain containing protein. (Os11t0146200-01);Anky rin repeat domain containing protein. (Os11t0146200-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0145700_circ_ag.1 |
| Support reads | 5/4 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0146200-02:3 Os11t0146200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.422028307 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2093260-2092982(+) 2093267-2093270(-) 2092962-2093077(-) |
| Potential amino acid sequence |
MTLLKPTRGLRLFGCIDSCGVGTILSQLNKP*(+) MSSKSSPRELTGKKKLTKHDDEALRFIELAENGTDPATIDASEEPKTSSWL*(-) MVPTPQLSMHPKSRRPLVGFSNVIKKLAKGTDWKEETD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015 |