Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G63770_circ_g.11 |
| ID in PlantcircBase | ath_circ_008546 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 23661222-23661734 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G63770 |
| Parent gene annotation |
Peptidase M1 family protein |
| Parent gene strand | - |
| Alternative splicing | AT1G63770_circ_g.10 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G63770.6:3 AT1G63770.5:3 AT1G63770.3:3 AT1G63770.1:3 AT1G63770.4:3 AT1G63770.2:3 AT1G63770.7:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.278906614 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23661288-23661224(-) |
| Potential amino acid sequence |
MGSRTVKRIADVSKLRIYQFPQIFNSKLVLASPETATDADYAAILGVIGHEYFHNWTGNRVTCR DWFQLSLKEGLTVFRDQEFSSDMGSRTVKRIADVSKLRIYQFPQIFNSKLVLASPETATDADYA AILGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDMGSRTVKRIADVSKLRIYQF PQIFNSKLVLASPETATDADYAAILGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFS SDMGSRTVKRIADVSKLRIYQFPQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |