Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G63770_circ_g.11 |
ID in PlantcircBase | ath_circ_008546 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 23661222-23661734 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G63770 |
Parent gene annotation |
Peptidase M1 family protein |
Parent gene strand | - |
Alternative splicing | AT1G63770_circ_g.10 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G63770.6:3 AT1G63770.5:3 AT1G63770.3:3 AT1G63770.1:3 AT1G63770.4:3 AT1G63770.2:3 AT1G63770.7:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.278906614 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23661288-23661224(-) |
Potential amino acid sequence |
MGSRTVKRIADVSKLRIYQFPQIFNSKLVLASPETATDADYAAILGVIGHEYFHNWTGNRVTCR DWFQLSLKEGLTVFRDQEFSSDMGSRTVKRIADVSKLRIYQFPQIFNSKLVLASPETATDADYA AILGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSSDMGSRTVKRIADVSKLRIYQF PQIFNSKLVLASPETATDADYAAILGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFS SDMGSRTVKRIADVSKLRIYQFPQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |