Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc11g013280.1_circ_g.2 |
| ID in PlantcircBase | sly_circ_003301 |
| Alias | 11:6210415|6211030 |
| Organism | Solanum lycopersicum |
| Position | chr11: 6210415-6211030 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc11g013280.1 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc11g013280.1_circ_g.1 |
| Support reads | 9 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc11g013280.1.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | csa_circ_000526* |
| PMCS | 0.956349252 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6210960-6211020(-) 6210519-6211010(-) |
| Potential amino acid sequence |
MVVEGFQLLSRWTARVWEQCAWKFSRPCKDPVPMESHDMPASFSDYEKVVRYNYNAEERKALVE LVSYIKSIGSMMQKVDTSVTDALWETIHAEVQDFVQNTLATMLRTTFRKKKDLSSLSC*(-) MPCGRQSMQRCKILFRIRLRQCCGLPSGKRKTFLACLAKIN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Tan et al., 2017; Yin et al., 2018 |