Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0662900_circ_g.1 |
| ID in PlantcircBase | osa_circ_025818 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 33829592-33831294 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0662900 |
| Parent gene annotation |
RNA polymerase III transcriptional repressor, MAF1 domain contai ning protein. (Os04t0662900-01);RNA polymerase III transcription al repressor, MAF1 domain containing protein. (Os04t0662900-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0662900_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0662900-02:8 Os04t0662900-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.154909195 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33831263-33829636(+) 33831221-33831293(-) 33829763-33831070(-) |
| Potential amino acid sequence |
MCLEKARSKAQMTPFSRNGSPSWSGL*(+) MKFLEYTPFDSINLFLDNLDLGDCTIRGNLEAFSCKHTGNDRRLSISLEHEILDCLSKSSDSDH SSPVEHLSCRSSRKTLIYLVLTLSHMYPDYDFSAVRAHLFFKEEEWESFKEMTDTYLSEASKQW AATNEGTSLLDSMTNVIDEVIKIGESDIYSYNPDQDGDPFLEKGVI*(-) MSLMRLSKSESLTSTAIIQTKMEIHFLKRGSSELLISPSRDTSDIAVLFMSSQDTQHEVFRIHP LRQYKSVP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |