Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G021000_circ_g.1 |
| ID in PlantcircBase | gra_circ_001298 |
| Alias | Chr12:2569740|2571530 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 2569740-2571530 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G021000 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.012G021000.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000270* gar_circ_000337* |
| PMCS | 0.095675302 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2571050-2571477(-) |
| Potential amino acid sequence |
MVRPCFPSVYHESQMPDVNTISETVVIVNDSWKVGDLVDWWTDNCFWTGTIIEKLDDENFKIEL PPPPKGEGCLYDVSCKDLRPSLDWSVDEGWKLPKGGKYHLYCARIVKPVYQDKGNWSEEQGTRT CLGIY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |