Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0691000_circ_g.1 |
| ID in PlantcircBase | osa_circ_032133 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 28811504-28812986 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0691000 |
| Parent gene annotation |
DNA-repair protein, UmuC-like domain containing protein. (Os06t0 691000-01);Hypothetical conserved gene. (Os06t0691000-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0691000-01:4 Os06t0691000-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147621522 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28812972-28811592(+) 28812974-28812983(-) |
| Potential amino acid sequence |
MPAFIPLECCEAGRSIPLLCSLVYLKQYDQCLGVL*(+) MFVREAKARCPHLMIVPYDFDAYGEVADQFYGILHKYCSKVQALSCDEAFLDMTECLHDNPEEV TQKIRNEIFGTTKCSASAGISGNMLIARLATRSAKPNGQCFISSEKVDGYLNTLSIKALPGIGH TVSDKLKSKEVEYCGQLRNIPKG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |