Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G224500_circ_g.1 |
| ID in PlantcircBase | gra_circ_001248 |
| Alias | Chr11:53539205|53539540 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 53539205-53539540 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G224500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.011G224500.5:2 Gorai.011G224500.2:2 Gorai.011G224500.9:2 Gorai.011G224500.8:2 Gorai.011G224500.4:2 Gorai.011G224500.10:2 Gorai.011G224500.3:2 Gorai.011G224500.7:2 Gorai.011G224500.1:2 Gorai.011G224500.6:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000159* |
| PMCS | 0.336981572 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53539257-53539537(+) |
| Potential amino acid sequence |
MPLVIKTGFAPAATTLTPSAIKPCARTTEVVVPSPAKSLVLAAACLTNLAPMFSTGSSNSTSFE IALSSDTKALVVFSMPLVIKTGFAPAATTLTPSAIKPCARTTEVVVPSPAKSLVLAAACLTNLA PMFSTGSSNSTSFEIALSSDTKALVVFSMPLVIKTGFAPAATTLTPSAIKPCARTTEVVVPSPA KSLVLAAACLTNLAPMFSTGSSNSTSFEIALSSDTKALVVFSMPLVIKTGFAPAATTLTPSAIK PCARTTEVVVPSPAKSLVLAAACLTNLAPMFSTGSSNS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |