Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G49140_circ_g.3 |
ID in PlantcircBase | ath_circ_026671 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 18213424-18213588 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G49140 |
Parent gene annotation |
Uncharacterized protein At3g49140 |
Parent gene strand | - |
Alternative splicing | AT3G49140_circ_g.1 AT3G49140_circ_g.2 |
Support reads | 8 |
Tissues | leaf, inflorescences, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G49140.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.454733683 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18213469-18213426(-) |
Potential amino acid sequence |
MRSCHPMFFAKRMTEEWVAILEDEDEDDDDDDDDDEDDDDSDSDESLGDWANLETMRSCHPMFF AKRMTEEWVAILEDEDEDDDDDDDDDEDDDDSDSDESLGDWANLETMRSCHPMFFAKRMTEEWV AILEDEDEDDDDDDDDDEDDDDSDSDESLGDWANLETMRSCHPMFFAKRMTE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |