Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G22890_circ_g.6 |
| ID in PlantcircBase | ath_circ_023271 |
| Alias | At_ciR4015 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 8114094-8114354 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, CIRI-full |
| Parent gene | AT3G22890 |
| Parent gene annotation |
ATP sulfurylase 1, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | AT3G22890_circ_g.1 AT3G22890_circ_g.2 AT3G22890_circ_g.3 AT3G22890_circ_g.4 AT3G22890_circ_g.5 |
| Support reads | 5/1 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G22890.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.477155461 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8114154-8114351(+) |
| Potential amino acid sequence |
MHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNIL PFRVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRD LYDADHGKKVLSMAPGLERLNILPFRVLEDGVLDPETTVVSIFPSPMHYAGPTEVQWHAKARIN AGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFRVLEDGVLDPETTVVS IFPSPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLE RLNILPFR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |