Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0818000_circ_g.4 |
| ID in PlantcircBase | osa_circ_004600 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 34835347-34835622 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0818000 |
| Parent gene annotation |
Auxin efflux carrier domain containing protein. (Os01t0818000-01 );Auxin efflux carrier domain containing protein. (Os01t0818000- 02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0818000-02:1 Os01t0818000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.425057609 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34835429-34835406(+) 34835580-34835401(+) |
| Potential amino acid sequence |
MMERSLMEALATAAQGGTVGTSVFDMLKYAVLPIAKVFTVCFMGFLMASKYVNILQPNGRKLLN GELRGSWLWKSGSEEEEEEVN*(+) MSISSSRTAASFSMGNCVGPGCGSQEVKKKKKK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |