Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G185500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000741 |
| Alias | Chr07:17782180|17782394 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 17782180-17782394 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G185500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.007G185500.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000164* ghi_circ_000176* |
| PMCS | 0.484559419 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17782224-17782222(-) |
| Potential amino acid sequence |
MTRSWVILNMQKKSQLLGVPLRQRRKCLKDLFHDEKLGHFEYAKEITAARCSSTPKKEMFEGFV S*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |