Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G39420_circ_g.14 |
| ID in PlantcircBase | ath_circ_035697 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 18352672-18352926 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT4G39420 |
| Parent gene annotation |
unknown protein |
| Parent gene strand | + |
| Alternative splicing | AT4G39420_circ_g.15 |
| Support reads | 8 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G39420.2:1 AT4G39420.3:1 AT4G39420.4:1 AT4G39420.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.429290149 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18352879-18352923(+) |
| Potential amino acid sequence |
MPAASIAQILAESFLKILENLSTILNEGSGRGLARKIIAVIKAANILGLTFTEAYQKQPIELLR LLSLKAQDSFEEACLLVQTHSMPAASIAQILAESFLKILENLSTILNEGSGRGLARKIIAVIKA ANILGLTFTEAYQKQPIELLRLLSLKAQDSFEEACLLVQTHSMPAASIAQILAESFLKILENLS TILNEGSGRGLARKIIAVIKAANILGLTFTEAYQKQPIELLRLLSLKAQDSFEEACLLVQTHSM PAASIAQILAESFLK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |