Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G39420_circ_g.14 |
ID in PlantcircBase | ath_circ_035697 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 18352672-18352926 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT4G39420 |
Parent gene annotation |
unknown protein |
Parent gene strand | + |
Alternative splicing | AT4G39420_circ_g.15 |
Support reads | 8 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G39420.2:1 AT4G39420.3:1 AT4G39420.4:1 AT4G39420.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.429290149 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18352879-18352923(+) |
Potential amino acid sequence |
MPAASIAQILAESFLKILENLSTILNEGSGRGLARKIIAVIKAANILGLTFTEAYQKQPIELLR LLSLKAQDSFEEACLLVQTHSMPAASIAQILAESFLKILENLSTILNEGSGRGLARKIIAVIKA ANILGLTFTEAYQKQPIELLRLLSLKAQDSFEEACLLVQTHSMPAASIAQILAESFLKILENLS TILNEGSGRGLARKIIAVIKAANILGLTFTEAYQKQPIELLRLLSLKAQDSFEEACLLVQTHSM PAASIAQILAESFLK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |