Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0235800_circ_g.4 |
| ID in PlantcircBase | osa_circ_027124 |
| Alias | Os_ciR10293 |
| Organism | Oryza sativa |
| Position | chr5: 8315939-8317112 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0235800 |
| Parent gene annotation |
DNA-dependent ATPase MCM domain containing protein. (Os05t023580 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0235800_circ_g.3 |
| Support reads | 2/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0235800-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.255428897 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8316256-8316019(+) 8315993-8317099(-) |
| Potential amino acid sequence |
MLADNGICCIDEFDKMDIKDQVAIHEAMEQQTISITKAGIQATLNARTSILAAANPTGGRYDKS KPLKYNVALPPAILSRFDLVYIMIDEPDENTDYHIAHHIVRVHQKREEALAPAFSTAELKRYIA FAKSLKPQLSSEAKKVLVESYVTLRRGDSTPGTRVAYRMTVRQLEALIRLSEAIARSHLERVIY RWYCSTICLHIREVLICCWFDSNCC*(+) MRTSLMCKQIVEQYQRYITLSK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |