Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0106900_circ_g.1 |
ID in PlantcircBase | osa_circ_010286 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 375298-375580 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0106900 |
Parent gene annotation |
Hemopexin domain containing protein. (Os12t0106900-01);Hypotheti cal conserved gene. (Os12t0106900-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0106900-01:1 Os12t0106900-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.534619792 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
375508-375340(+) 375552-375578(-) |
Potential amino acid sequence |
MWNHTWPLKRTLDSIRGFTASNSSSNDGACFNDRNWEWK*(+) MESSVRFRGQVWFHINFWARSRKSKKIKRFFAEVHYKPPSSSSSVCSYLPFPVPGAERPPSSSS VSSDLLLPLPIPVVEACTIIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |