Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d032790_circ_g.3 |
ID in PlantcircBase | zma_circ_006821 |
Alias | Zm01circ00150, GRMZM2G116526_C1 |
Organism | Zea mays |
Position | chr1: 238223492-238224261 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d032790 |
Parent gene annotation |
plastid transcriptionally active 3 |
Parent gene strand | - |
Alternative splicing | Zm00001d032790_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d032790_T003:2 Zm00001d032790_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.196289022 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
238224216-238223504(+) 238224218-238223558(-) |
Potential amino acid sequence |
MFSNVAKATSGIPQVACHRT*(+) MEYGGEDYMKPDTESYNWVIQAFTRATSYDRLLVEFLKLPLQHLKTWNMEVKIT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |