Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d032790_circ_g.3 |
| ID in PlantcircBase | zma_circ_006821 |
| Alias | Zm01circ00150, GRMZM2G116526_C1 |
| Organism | Zea mays |
| Position | chr1: 238223492-238224261 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d032790 |
| Parent gene annotation |
plastid transcriptionally active 3 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d032790_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d032790_T003:2 Zm00001d032790_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.196289022 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
238224216-238223504(+) 238224218-238223558(-) |
| Potential amino acid sequence |
MFSNVAKATSGIPQVACHRT*(+) MEYGGEDYMKPDTESYNWVIQAFTRATSYDRLLVEFLKLPLQHLKTWNMEVKIT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |