Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0497300_circ_g.3 |
| ID in PlantcircBase | osa_circ_037495 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 24563901-24564060 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0497300 |
| Parent gene annotation |
Cellular retinaldehyde binding/alpha-tocopherol transport family protein. (Os08t0497300-01);Similar to SEC14 cytosolic factor (S ecretion factor 14) family protein (Fragment). (Os08t0497300-02) ;Similar to phosphatidylinositol transporter/ transporter. (Os08 t0497300-03) |
| Parent gene strand | + |
| Alternative splicing | Os08g0497300_circ_g.2 Os08g0497300_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0497300-01:1 Os08t0497300-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24563998-24563929(+) 24564053-24563929(+) |
| Potential amino acid sequence |
MVQNQLPDNRQPSTNRNPHDSGKGNRFFDLL*(+) MTQVRGTDSLTYYSCDDQTRRDIAPESCKGVQATGMVQNQLPDNRQPSTNRNPHDSGKGNRFFD LL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |