Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0497300_circ_g.3 |
ID in PlantcircBase | osa_circ_037495 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 24563901-24564060 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0497300 |
Parent gene annotation |
Cellular retinaldehyde binding/alpha-tocopherol transport family protein. (Os08t0497300-01);Similar to SEC14 cytosolic factor (S ecretion factor 14) family protein (Fragment). (Os08t0497300-02) ;Similar to phosphatidylinositol transporter/ transporter. (Os08 t0497300-03) |
Parent gene strand | + |
Alternative splicing | Os08g0497300_circ_g.2 Os08g0497300_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0497300-01:1 Os08t0497300-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24563998-24563929(+) 24564053-24563929(+) |
Potential amino acid sequence |
MVQNQLPDNRQPSTNRNPHDSGKGNRFFDLL*(+) MTQVRGTDSLTYYSCDDQTRRDIAPESCKGVQATGMVQNQLPDNRQPSTNRNPHDSGKGNRFFD LL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |