Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G23090_circ_g.1 |
ID in PlantcircBase | ath_circ_023322 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 8214863-8215246 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT3G23090 |
Parent gene annotation |
TPX2 (Targeting protein for Xklp2) protein family |
Parent gene strand | - |
Alternative splicing | AT3G23090_circ_g.2 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G23090.2:2 AT3G23090.1:2 AT3G23090.4:2 AT3G23090.5:2 AT3G23090.3:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.15604755 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8215214-8214865(-) |
Potential amino acid sequence |
MEAEKTQSEARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKKFYTKLEEKHQAMEA EKTQSEARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKKFYTKLEEKHQAMEAEKT QSEARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKKFYTKLEEKHQAMEAEKTQSE ARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |