Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G23090_circ_g.1 |
| ID in PlantcircBase | ath_circ_023322 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 8214863-8215246 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT3G23090 |
| Parent gene annotation |
TPX2 (Targeting protein for Xklp2) protein family |
| Parent gene strand | - |
| Alternative splicing | AT3G23090_circ_g.2 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G23090.2:2 AT3G23090.1:2 AT3G23090.4:2 AT3G23090.5:2 AT3G23090.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.15604755 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8215214-8214865(-) |
| Potential amino acid sequence |
MEAEKTQSEARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKKFYTKLEEKHQAMEA EKTQSEARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKKFYTKLEEKHQAMEAEKT QSEARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKKFYTKLEEKHQAMEAEKTQSE ARNKEATEAALRQLRKSLRFKANPMPKFYHEGPPPKVELKK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |