Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0327400_circ_g.6 |
| ID in PlantcircBase | osa_circ_036747 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 14418009-14418434 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, circRNA_finder |
| Parent gene | Os08g0327400 |
| Parent gene annotation |
Similar to Enoyl-ACP reductase (Fragment). (Os08t0327400-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0327400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16882144 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14418384-14418019(+) 14418400-14418019(+) 14418377-14418404(-) |
| Potential amino acid sequence |
MIEYSYVNAPLQKELLAGTCF*(+) MLMHRCRKNCWQVLAFEAGRKGKIRVNTISAGPLGSRAAKAIGFIEKMIEYSYVNAPLQKELLA GTCF*(+) MNPIALAARLPKGPADMVLTLIFPFLPASKASTCQQFFLQRCINIRVFYHLLNESNCLGSSASQ RTCRYGVNSDFPFPSSFKSKYLPTVLSATVH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |