Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g093220.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000856 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr2: 54158645-54159708 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc02g093220.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc02g093220.2.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141484641 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
54158719-54159673(-) 54159646-54159657(-) |
| Potential amino acid sequence |
MCQQSIITIFMGHYWDHRYRCCSAGQVLCAGNGDRG*(-) MSFSGWKVDDDSTTRLVLHAYSLKELDISRSRWGCQITDRGLYQLSTAKCVSNLSSLSLWGTTG ITDTGVVQLDKCCVQEMETGGEGIVS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016 |