Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0837900_circ_g.2 |
ID in PlantcircBase | osa_circ_004773 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 35926218-35927599 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0837900 |
Parent gene annotation |
Similar to Protein kinase AFC1 (EC 2.7.1.-). (Os01t0837900-01);N on-protein coding transcript. (Os01t0837900-02) |
Parent gene strand | - |
Alternative splicing | Os01g0837900_circ_g.1 Os01g0837900_circ_g.3 Os01g0837900_circ_g.4 Os01g0837900_circ_g.5 Os01g0837900_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0837900-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.307348897 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35927503-35927496(-) |
Potential amino acid sequence |
MIEIDVLQRLGKHDFTGSRCVQIRNWFDYRNHICIVFERLGPSLYDFLRKNSYRAFPIDLVREF ARQILESVAFMHDLRLIHTDLKPENILLVSSESIRVPDYKVTIRPPKDGSFFKNLPKSSAIKLI DFGSTTFEHQDHNYVVSTRHYRAPEVILGLGWNYSCDLWSVGCILVELCSGEALFQTHENLEHL AMMERVLGPLPKHMIVRAEDFWTSLRVLGLGTPRDSGYQNCALPSEISRGCYD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |