Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0356500_circ_g.1 |
ID in PlantcircBase | osa_circ_001691 |
Alias | Os_ciR5741 |
Organism | Oryza sativa |
Position | chr1: 14394552-14395579 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0356500 |
Parent gene annotation |
Thiamin pyrophosphokinase, eukaryotic domain containing protein. (Os01t0356500-01) |
Parent gene strand | - |
Alternative splicing | Os01g0356500_circ_g.2 Os01g0356500_circ_g.3 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0356500-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.358824908 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14395553-14395561(-) 14394567-14395561(-) |
Potential amino acid sequence |
MDSIRPEVKQFYSSQGSKISDKSHNQETTDLHKCISRIHRCTPDHEKTNVYSRNN*(-) MKKQMYIPEIIEGDMDSIRPEVKQFYSSQGSKISDKSHNQETTDLHKCISRIHRCTPDHEKTNV YSRNN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |