Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d006470_circ_g.2 |
ID in PlantcircBase | zma_circ_007366 |
Alias | zma_circ_0000909 |
Organism | Zea mays |
Position | chr2: 209233574-209233805 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d006470 |
Parent gene annotation |
Methionine aminopeptidase |
Parent gene strand | + |
Alternative splicing | Zm00001d006470_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | NA:0 Zm00001d006470_T007:1 Zm00001d006470_T006:1 Zm00001d006470_T008:1 Zm00001d006470_T005:1 Zm00001d006470_T001:1 Zm00001d006470_T004:1 Zm00001d006470_T002:1 Zm00001d006470_T003:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.307834737 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
209233747-209233699(+) 209233665-209233799(-) 209233676-209233732(-) |
Potential amino acid sequence |
MRAACKLAARVLDFAGTLVKVTRAKFSKIKEKATFEAWKGLPTTSCTRAHSKTILCWCERIA*( +) MCPGTGSCGETFPRLKGGLFFDFTELCSCDLN*(-) MVLECALVQEVVGRPFHASKVAFSLILLNFALVTLTKVPAKSRTRAASLQAALIPVIP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |