Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d006470_circ_g.2 |
| ID in PlantcircBase | zma_circ_007366 |
| Alias | zma_circ_0000909 |
| Organism | Zea mays |
| Position | chr2: 209233574-209233805 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d006470 |
| Parent gene annotation |
Methionine aminopeptidase |
| Parent gene strand | + |
| Alternative splicing | Zm00001d006470_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | NA:0 Zm00001d006470_T007:1 Zm00001d006470_T006:1 Zm00001d006470_T008:1 Zm00001d006470_T005:1 Zm00001d006470_T001:1 Zm00001d006470_T004:1 Zm00001d006470_T002:1 Zm00001d006470_T003:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.307834737 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
209233747-209233699(+) 209233665-209233799(-) 209233676-209233732(-) |
| Potential amino acid sequence |
MRAACKLAARVLDFAGTLVKVTRAKFSKIKEKATFEAWKGLPTTSCTRAHSKTILCWCERIA*( +) MCPGTGSCGETFPRLKGGLFFDFTELCSCDLN*(-) MVLECALVQEVVGRPFHASKVAFSLILLNFALVTLTKVPAKSRTRAASLQAALIPVIP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |