Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0633600_circ_g.2 |
ID in PlantcircBase | osa_circ_012462 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 27156847-27157436 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0633650 |
Parent gene annotation |
Hypothetical protein. (Os12t0633650-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0633600-01:2 Os12t0633650-00:2 Os12t0633600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008994 |
PMCS | 0.363727684 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27157402-27156897(+) 27157066-27157258(-) |
Potential amino acid sequence |
MFEFPVCLLSTSFSSIPFRKGSLCCNCSS*(+) MKWVTDLAPEPDDVYWSNLWLPYKQLWIRRIATLLGSIVFMLFFLIPVTFIQGLSQLEQLQQRL PFLKGILEKLVLRRHTGNSNILQTALLIRGVEQFHTGAVCAEPHLILSSCWQLGLSRIRGNLTF KIPA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |