Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0246600_circ_g.2 |
| ID in PlantcircBase | osa_circ_008969 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 7911823-7914155 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0246600 |
| Parent gene annotation |
Similar to Peptidase S1 and S6, chymotrypsin/Hap. (Os11t0246600- 00) |
| Parent gene strand | + |
| Alternative splicing | Os11g0246600_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0246600-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009452 |
| PMCS | 0.227076339 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7914071-7911829(+) |
| Potential amino acid sequence |
MKVWAADGLSFAVPIDSIVKIVENFKKNGLV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |