Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0246600_circ_g.2 |
ID in PlantcircBase | osa_circ_008969 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 7911823-7914155 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0246600 |
Parent gene annotation |
Similar to Peptidase S1 and S6, chymotrypsin/Hap. (Os11t0246600- 00) |
Parent gene strand | + |
Alternative splicing | Os11g0246600_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0246600-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009452 |
PMCS | 0.227076339 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7914071-7911829(+) |
Potential amino acid sequence |
MKVWAADGLSFAVPIDSIVKIVENFKKNGLV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |